PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG133800.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 543aa    MW: 61396.9 Da    PI: 7.9609
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG133800.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS251.43.6e-772515081260
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l+ lL++cA+a+  ++l  a +lL++++++asp+gd+ qRla yf+++L+arla+++ ++y++l  ++t+    ++ l+a++lf+ ++P+
  Pavir.1KG133800.3.p 251 LRALLIQCAQAIVVNNLPFAGELLKKIRQHASPYGDSSQRLALYFANGLEARLAGTGFKMYQKLMEKRTR---ATDMLKAYRLFVAACPF 337
                          5789*********************************************************999999998...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +k+++   Nq+I + +++  +vHiiDf+i++G+QWp+L++ +a+R++gpp+lRiTg+g p++g     ++ +tg+rLa++A+ ++vpf++
  Pavir.1KG133800.3.p 338 PKVAYYFSNQTIADVLNRRPKVHIIDFGITMGFQWPSLIKRFAKREGGPPKLRITGIGVPQPGfrPCAMIDATGKRLAEYAKMFNVPFQY 427
                          **************************************************************999999********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                          +  +a+r+e++ +e+L+++++E+l+Vn+++q ++l de+ +++s+rd+vL+++k+++P+v+++   +  +ns+ Fl rf e 
  Pavir.1KG133800.3.p 428 QG-IASRWENICIEDLNIDKDEVLIVNCMYQTKYLGDETEDIDSARDRVLRIMKKINPEVLILGMINGFYNSPFFLPRFREH 508
                          **.7***************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.507225542IPR005202Transcription factor GRAS
PfamPF035141.2E-74251508IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MESPEYCEIN SNMTLDYINR LLMEDTDERA SIYQQHDALQ ATEKPFYDIL GQAYPSSSPK  60
ETMIHTYSHI DCPQDSSNSY TEREGSGSFA SDILGPQGTQ LVANDWVSEC DRLSSQFQRG  120
AEEANKLVPS IEKLVVDLDS NGHSDYNQMI GAATGQKIKH VNKIWNHPHA DLELSEARNS  180
KHLAISASET IRDETFDSVL LCDWEVHSDA AYLREMKVKE ASNSRQNVQS KEYGQGQVKS  240
RGKKKEEGID LRALLIQCAQ AIVVNNLPFA GELLKKIRQH ASPYGDSSQR LALYFANGLE  300
ARLAGTGFKM YQKLMEKRTR ATDMLKAYRL FVAACPFPKV AYYFSNQTIA DVLNRRPKVH  360
IIDFGITMGF QWPSLIKRFA KREGGPPKLR ITGIGVPQPG FRPCAMIDAT GKRLAEYAKM  420
FNVPFQYQGI ASRWENICIE DLNIDKDEVL IVNCMYQTKY LGDETEDIDS ARDRVLRIMK  480
KINPEVLILG MINGFYNSPF FLPRFREHAK VQKGLRGQRL TNSGKQEVLR LGSSNFLLIK  540
QS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-372555058255GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008648647.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A096RDF20.0A0A096RDF2_MAIZE; Uncharacterized protein
STRINGGRMZM2G089636_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-109GRAS family protein